PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00004412-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family bHLH
Protein Properties Length: 211aa    MW: 23875.3 Da    PI: 9.2075
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00004412-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH21.63.9e-074591755
                        HHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                 HLH  7 erErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                          Er+RR+++    + Lr+llP  +    +K s ++   +Av+YIk+L+
  WALNUT_00004412-RA 45 DTERQRRQKMAILNASLRSLLPVEM--IMGKRSLSDHMSEAVNYIKYLK 91
                        67*********************63..********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.13E-935105IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088811.6043890IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.13E-43895No hitNo description
Gene3DG3DSA:4.10.280.108.6E-744106IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS514507.47393114IPR001611Leucine-rich repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MLRDTAERQS RSSFNVAKSL PHKISSTSDN DEANTGNNKK IIRRDTERQR RQKMAILNAS  60
LRSLLPVEMI MGKRSLSDHM SEAVNYIKYL KNKLEELSVR SNKLKELSNF SVLGLGNQRS  120
DNNLQNRVMV HPCWDGVEIV ITSNVNEDSL LLSEVLEILL EEALSVVTCS STKANERLIY  180
TIQAKVNDFG CGLDLHELQR KLNALVMSST R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109064.14e-56hypothetical protein L484_012939
TrEMBLW9S1D94e-56W9S1D9_9R
STRINGVIT_16s0022g02250.t014e-51(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51780.18e-38bHLH family protein